PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C023853P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 324aa    MW: 34444.4 Da    PI: 9.0158
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C023853P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.5e-3975135262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +e+ lkcprC+stntkfCy+nny+lsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  MELO3C023853P1  75 PEAGLKCPRCESTNTKFCYFNNYNLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 135
                     67889*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3459128IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3278133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.76779133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MVFPPLPSYL DPPNWQPLTN HQTGGNDTAE DSGQVLLPPP PGGGGGGESA GGGSTGSIRP  60
ISMTDRARLA KIPQPEAGLK CPRCESTNTK FCYFNNYNLS QPRHFCKTCR RYWTRGGALR  120
NVPVGGGCRR NKRTKSRNRS KSPAASERQL LVGSTNSTAA VSLSTQPHLP FLSSLQNFST  180
YGLNLGIIPP QAPPTSGGSA AGGVDVHEFQ GDHWRLQQPQ QFPLLANDQQ PNLLYTFEPP  240
EGAMTRYNLG GFSRLGIEND IGMSMEGEAV KVEESKGMNL GKNFQFWVGG GGGNDVNAWS  300
GGGSGGSELH GFSSSSASHL LRQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818970.0LN681897.1 Cucumis melo genomic scaffold, anchoredscaffold00063.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008461665.10.0PREDICTED: dof zinc finger protein DOF2.4
TrEMBLA0A0A0KQ920.0A0A0A0KQ92_CUCSA; Uncharacterized protein
STRINGVIT_13s0019g01410.t017e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.16e-44DNA binding with one finger 2.4